Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NDLNELKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWE |
Predicted Species | Mouse (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | WDR26 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-83628 | Applications | Species |
---|---|---|
Patel L, Stratton S, McLaughlin M et al. Genome-wide CRISPR-Cas9 screen analyzed by SLIDER identifies network of repressor complexes that regulate TRIM24 iScience 2023-07-01 [PMID: 37426340] (WB, Human) | WB | Human |
Patel L, Stratton S, McLaughlin M et al. Genomewide CRISPR/Cas9 Screen Identifies Network of Repressor Complexes That Regulate TRIM24 SSRN Electronic Journal 2022-08-25 |
Secondary Antibodies |
Isotype Controls |
Research Areas for WDR26 Antibody (NBP1-83628)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | WDR26 |