![Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize/VDAC3-Antibody-Western-Blot-NBP1-80070-img0006.jpg "Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VDAC3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-80070 | Applications | Species |
|---|---|---|
| Chen WM, Chiang JC, Shang Z et al. DNA-PKcs and ATM modulate mitochondrial ADP-ATP exchange as an oxidative stress checkpoint mechanism The EMBO journal 2023-02-02 [PMID: 36727301] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for VDAC3 Antibody (NBP1-80070)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: VDAC3 Antibody [NBP1-80070] - Human Lung cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://images.novusbio.com/fullsize/VDAC3-Antibody-Immunohistochemistry-NBP1-80070-img0003.jpg "Immunohistochemistry: VDAC3 Antibody [NBP1-80070] - Human Lung cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.")
![Western Blot: VDAC3 Antibody [NBP1-80070] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/VDAC3-Antibody-Western-Blot-NBP1-80070-img0002.jpg "Western Blot: VDAC3 Antibody [NBP1-80070] - Human Heart lysate, concentration 0.2-1 ug/ml.")
![Western Blot: VDAC3 Antibody [NBP1-80070] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml VDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://images.novusbio.com/fullsize/VDAC3-Antibody-Western-Blot-NBP1-80070-img0004.jpg "Western Blot: VDAC3 Antibody [NBP1-80070] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml VDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.")
![Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize/VDAC3-Antibody-Western-Blot-NBP1-80070-img0005.jpg "Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.")
![Simple Western BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Simple_Western_16992.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_22585.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_9663.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")