Home » VAP-1/AOC3 » VAP-1 Peptides and Proteins » VAP-1/AOC3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

VAP-1/AOC3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VAP-1/AOC3 Protein (NBP1-89671PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VAP-1/AOC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AOC3.

Source: E. coli

Amino Acid Sequence: DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AOC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89671.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VAP-1/AOC3 Recombinant Protein Antigen

  • amine oxidase, copper containing 3 (vascular adhesion protein 1)
  • AOC3
  • Copper amine oxidase
  • EC 1.4.3
  • HPAO
  • HPAOSSAO
  • Semicarbazide-sensitive amine oxidase
  • SSAO
  • VAP1
  • VAP-1
  • VAP1EC 1.4.3.21
  • VAP-1membrane primary amine oxidase
  • Vascular adhesion protein 1

Background

Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The product is a major protein on the adipocyte plasma membrane. It has adhesive properties and also has functional monoamine oxidase activity. A pseudogene for this gene has been described and is located approximately 9-kb downstream.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAO-A Antibody
NBP2-38868
Immunocytochemistry/ Immunofluorescence MAO-A Antibody
Immunohistochemistry-Paraffin MAO-A Antibody
Immunohistochemistry-Paraffin MAO-A Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Monoamine Oxidase
B Antibody
NBP1-87493
Immunohistochemistry-Paraffin Monoamine Oxidase B Antibody
Immunohistochemistry-Paraffin Monoamine Oxidase B Antibody
Immunohistochemistry-Paraffin Monoamine Oxidase B Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
LOX Antibody
NB100-2527
Immunocytochemistry/ Immunofluorescence LOX Antibody
Immunohistochemistry LOX Antibody
Western Blot LOX Antibody
(5 Reviews)
(38 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(85 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
MAdCAM-1
[Unconjugated]
6056-MC
MAdCAM-1 [Unconjugated]
(15 Publications)
Species: Hu
Applications: BA
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
(1 Review)
(60 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
(2 Reviews)
(11 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
P-Selectin/CD62P
137-PS
P-Selectin/CD62P
(45 Publications)
Species: Hu
Applications: BA
Recombinant Human
AOC2 GST (N-Term) Pro ...
H00000314-P01
SDS-PAGE Recombinant Human AOC2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(477 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Hemoglobin alpha
Antibody - BSA Free
NB110-41083
Hemoglobin alpha Antibody - BSA Free
(12 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB

Publications for VAP-1/AOC3 Protein (NBP1-89671PEP) (0)

There are no publications for VAP-1/AOC3 Protein (NBP1-89671PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAP-1/AOC3 Protein (NBP1-89671PEP) (0)

There are no reviews for VAP-1/AOC3 Protein (NBP1-89671PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VAP-1/AOC3 Protein (NBP1-89671PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VAP-1/AOC3 Products

Research Areas for VAP-1/AOC3 Protein (NBP1-89671PEP)

Find related products by research area.

Blogs on VAP-1/AOC3

There are no specific blogs for VAP-1/AOC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in control (vector only transfected HEK293T lysate) and aOC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
VAP-1/AOC3 Antibody
NBP1-89671
CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
CD31/PECAM-1 Antibody [Unconjugated]
AF3628
ICAM-1/CD54 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse ICAM-1/CD54 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF796) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in Leydig cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
ICAM-1/CD54 Antibody [Unconjugated]
AF796

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VAP-1/AOC3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AOC3