![Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis using Anti-UQCRC1 antibody NBP1-85329 (A) shows similar pattern to independent antibody NBP1-85328 (B).](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Western-Blot-NBP1-85329-img0015.jpg "Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis using Anti-UQCRC1 antibody NBP1-85329 (A) shows similar pattern to independent antibody NBP1-85328 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UQCRC1 |
![Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining in human heart muscle and lymph node tissues using anti-UQCRC1 antibody. Corresponding UQCRC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85329-img0013.jpg "Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining in human heart muscle and lymph node tissues using anti-UQCRC1 antibody. Corresponding UQCRC1 RNA-seq data are presented for the same tissues.")
![Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Western-Blot-NBP1-85329-img0006.jpg "Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in human cell line HEK 293.")
![Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Western-Blot-NBP1-85329-img0014.jpg "Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85329-img0009.jpg "Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/UQCRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85329-img0010.jpg "Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human lymph node shows low expression as expected.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")