UBAP1 Recombinant Protein Antigen

Images

 
There are currently no images for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to UBAP1.

Source: E. coli

Amino Acid Sequence: TMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58969.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBAP1 Recombinant Protein Antigen

  • MGC119669
  • MGC8710
  • NAG20
  • Nasopharyngeal carcinoma-associated gene 20 protein
  • UAP
  • UBAP
  • UBAP-1
  • ubiquitin associated protein 1
  • ubiquitin associated protein
  • ubiquitin-associated protein 1

Background

UBAP1 is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
DY1707
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-77452
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP1-92089
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-60075
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45412
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF4274
Species: Mu
Applications: IHC, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
7268-CT
Species: Hu
Applications: BA

Publications for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP) (0)

There are no publications for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP) (0)

There are no reviews for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UBAP1 Recombinant Protein Antigen (NBP2-58969PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBAP1 Products

Blogs on UBAP1.

Chinese Cancer Study Reveals Three New Genes for Nasopharyngeal Carcinomas
A large percentage of the products in our antibody catalog are used for cancer research. Some oncogenes are expressed in several types of tumor, while others are quite specific. For example, there are several products on our antibody database which ta...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

UBAP1 Antibody
NBP1-80651

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBAP1