U2AF1L4 Antibody Summary
Immunogen |
U2AF1L4 (AAH21186.1, 1 a.a. - 202 a.a.) full-length human protein. MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHVVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
U2AF1L4 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
This antibody is useful for Western Blot, Immunofluorescence |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for U2AF1L4 Antibody
Background
RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutiveand enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required foraccurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participatesin the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T cell activation; anevent reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, Simple Western, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: WB, ICC/IF
Publications for U2AF1L4 Antibody (H00199746-B01P) (0)
There are no publications for U2AF1L4 Antibody (H00199746-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for U2AF1L4 Antibody (H00199746-B01P) (0)
There are no reviews for U2AF1L4 Antibody (H00199746-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for U2AF1L4 Antibody (H00199746-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional U2AF1L4 Products
Research Areas for U2AF1L4 Antibody (H00199746-B01P)
Find related products by research area.
|
Blogs on U2AF1L4