TRF-1 Recombinant Protein Antigen

Images

 
There are currently no images for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TRF-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRF-1.

Source: E. coli

Amino Acid Sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TERF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57285.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRF-1 Recombinant Protein Antigen

  • NIMA-interacting protein 2
  • PIN-2
  • PIN2hTRF1-AS
  • Telomeric protein Pin2/TRF1
  • telomeric repeat binding factor (NIMA-interacting) 1
  • telomeric repeat binding factor 1
  • telomeric repeat binding protein 1
  • telomeric repeat-binding factor 1
  • TERF1
  • TRBF1
  • TRF1
  • TRF-1
  • TRF1FLJ41416
  • TRFt-TRF1
  • TTAGGG repeat-binding factor 1

Background

Telomeric repeat binding factor 1 (TRF1, TERF1, PIN2, TRBF1) and telomeric repeat binding factor 2 (TRF2, TERF2, TRBF2) are present at telomeres throughout the cell cycle, where they regulate telomerase by acting in cis to limit the elongation of individual chromosome ends. Telomerase adds hexameric repeats of TTAGGG to the ends of chromosomal DNA. This telomerase enzyme plays an influential role in cellular immortalization and cellular senescence. TRF1 negatively regulates telomere elongation, while TRF2 protects the chromosome ends by inhibiting end-to-end fusions. Downregulation of TRF expression in tumor cells may contribute to cell immortalization and malignant progression. TRF1 has an acidic N-terminus while TRF2 has a basic N-terminus. TRF2 localizes in the nucleolus at G0 and S and diffuses out of the nucleolus in G2 phase. During mitosis TRF2 disperses from the condensed chromosomes and returns to the nucleolus at cytokinesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
2914-HT
Species: Hu
Applications: BA
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
M5000
Species: Mu
Applications: ELISA
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
202-IL
Species: Hu
Applications: BA
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-176
Species: Hu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF7116
Species: Hu
Applications: WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
MAB7670
Species: Hu
Applications: ICC, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
DY1707
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA

Publications for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)

There are no publications for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)

There are no reviews for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRF-1 Products

Research Areas for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP)

Find related products by research area.

Blogs on TRF-1

There are no specific blogs for TRF-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRF-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TERF1