Home » TRAF-6 » TRAF-6 Proteins » Recombinant Human TRAF-6 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human TRAF-6 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human TRAF-6 Protein [H00007189-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human TRAF-6 Protein [H00007189-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human TRAF-6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 413-522 of Human TRAF-6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRAF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRAF-6 GST (N-Term) Protein

  • E3 ubiquitin-protein ligase TRAF6
  • EC 6.3.2.-
  • Interleukin-1 signal transducer
  • RING finger protein 85
  • RNF85MGC:3310
  • TNF receptor-associated factor 6
  • TRAF6
  • TRAF-6

Background

TRAF6 - TNF receptor-associated factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/ Immunofluorescence TRAF-2 Antibody
Immunohistochemistry TRAF-2 Antibody
Immunohistochemistry-Paraffin TRAF-2 Antibody
(4 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(140 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
RANK/TNFRSF11A
Antibody (9A725) - BS ...
NB100-56508
Flow Cytometry RANK/TNFRSF11A Antibody (9A725) - BSA Free
Flow Cytometry RANK/TNFRSF11A Antibody (9A725) - BSA Free
Flow Cytometry RANK/TNFRSF11A Antibody (9A725) - BSA Free
(19 Publications)
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
IRAK1 Antibody -
BSA Free
NBP1-77068
Western Blot IRAK1 Antibody - BSA Free
Western Blot IRAK1 Antibody - BSA Free
Western Blot IRAK1 Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB

TRANCE/TNFSF11/RANK L
462-TEC
SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]
Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]
(90 Publications)
Species: Mu
Applications: BA
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(99 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(594 Publications)
Species: Hu
Applications: BA
TANK Antibody
NB100-56144
Immunohistochemistry TANK Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(660 Publications)
Species: Mu
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TRAF-3 Antibody
NB100-56176
Immunohistochemistry-Paraffin TRAF-3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TAK1 Antibody
NB100-56363
Immunohistochemistry-Paraffin TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
TR4/NR2C2 Antibody
(H0107B) [Unconjugate ...
PP-H0107B-00
Immunocytochemistry/ Immunofluorescence TR4/NR2C2 Antibody (H0107B) [Unconjugated]
Western Blot TR4/NR2C2 Antibody (H0107B) [Unconjugated]
(3 Publications)
Species: Hu
Applications: DirELISA, IHC, IP, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB

Publications for TRAF-6 Partial Recombinant Protein (H00007189-Q01) (0)

There are no publications for TRAF-6 Partial Recombinant Protein (H00007189-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-6 Partial Recombinant Protein (H00007189-Q01) (0)

There are no reviews for TRAF-6 Partial Recombinant Protein (H00007189-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAF-6 Partial Recombinant Protein (H00007189-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF-6 Products

Research Areas for TRAF-6 Partial Recombinant Protein (H00007189-Q01)

Find related products by research area.

Blogs on TRAF-6

There are no specific blogs for TRAF-6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRAF-6 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TRAF6