Trace Amine Receptor 1 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TAAR1 (NP_612200.1). TSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFY |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TAAR1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500-1:2000
|
Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Trace Amine Receptor 1 Antibody - Azide and BSA Free
Background
TA1 (Trace amine receptor 1) is a member of the G protein coupled receptor family (subfamily trace amine). It is activated by endogenous trace amines as well as metabolites of the biogenic amine neurotransmitters. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. This receptor is mediated by the G(s)-class of G-proteins which activate adenylate cyclase. TA1 has been reported in human brain, dorsal root ganglion, olfactory bulb, kidney, liver, lung, pancreas, prostate, skeletal muscle, small intestine, spleen, spinal cord, and stomach. An EST for TA1 has been identified from a human stomach cancer library.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: BA
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Trace Amine Receptor 1 Antibody (NBP2-93938) (0)
There are no publications for Trace Amine Receptor 1 Antibody (NBP2-93938).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Trace Amine Receptor 1 Antibody (NBP2-93938) (0)
There are no reviews for Trace Amine Receptor 1 Antibody (NBP2-93938).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Trace Amine Receptor 1 Antibody (NBP2-93938) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Trace Amine Receptor 1 Products
Research Areas for Trace Amine Receptor 1 Antibody (NBP2-93938)
Find related products by research area.
|
Blogs on Trace Amine Receptor 1