![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP3-17045-img0006.jpg "Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human liver shows low expression as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STDMAGLEESFRKFAIHGDPKASGQEMNGKNWA |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPPP3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TPPP3 Antibody (NBP3-17045)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TPPP3 |
![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP3-17045-img0001.jpg "Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human hypothalamus shows strong nuclear and cytoplasmic positivity in glial cells.](http://images.novusbio.com/fullsize/TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP3-17045-img0002.jpg "Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human hypothalamus shows strong nuclear and cytoplasmic positivity in glial cells.")
![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP3-17045-img0003.jpg "Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Analysis in human fallopian tube and liver tissues using Anti-TPPP3 antibody. Corresponding TPPP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP3-17045-img0005.jpg "Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP3-17045] - Analysis in human fallopian tube and liver tissues using Anti-TPPP3 antibody. Corresponding TPPP3 RNA-seq data are presented for the same tissues.")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")