![Western Blot: TPPP/p25 Antibody [NBP1-80962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-592](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Western-Blot-NBP1-80962-img0005.jpg "Western Blot: TPPP/p25 Antibody [NBP1-80962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-592")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC |
| Predicted Species | Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPPP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TPPP/p25 Antibody (NBP1-80962)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0023.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows nuclear and cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0012.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows nuclear and cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lymph node.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0013.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human placenta shows no positivity in trophoblastic cells and weak cytoplasmic and nuclear staining in Hofbauer cells.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0014.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human placenta shows no positivity in trophoblastic cells and weak cytoplasmic and nuclear staining in Hofbauer cells.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human pancreas shows cytoplasmicand nuclear positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0015.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human pancreas shows cytoplasmicand nuclear positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0016.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0017.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human liver.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human colon.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0018.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human colon.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex, liver, lower gastrointestinal and pancreas using Anti-TPPP antibody NBP1-80962 (A) shows similar protein distribution across tissues to independent antibody NBP2-34031 (B).](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0019.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex, liver, lower gastrointestinal and pancreas using Anti-TPPP antibody NBP1-80962 (A) shows similar protein distribution across tissues to independent antibody NBP2-34031 (B).")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Analysis in human cerebral cortex and liver tissues using NBP1-80962 antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0020.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Analysis in human cerebral cortex and liver tissues using NBP1-80962 antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0021.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lower gastrointestinal shows moderate cytoplasmic positivity in peripheral ganglion.](http://images.novusbio.com/fullsize/TPPP-p25-Antibody-Immunohistochemistry-Paraffin-NBP1-80962-img0022.jpg "Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-80962] - Staining of human lower gastrointestinal shows moderate cytoplasmic positivity in peripheral ganglion.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")