![Western Blot: TMEM2 Antibody [NBP1-94168] - Analysis in human cell lines A-549 and PC-3 using anti-TMEM2 antibody. Corresponding TMEM2 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Western-Blot-NBP1-94168-img0018.jpg "Western Blot: TMEM2 Antibody [NBP1-94168] - Analysis in human cell lines A-549 and PC-3 using anti-TMEM2 antibody. Corresponding TMEM2 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
![Western Blot Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Western_Blot_6164.jpg)
![Immunohistochemistry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Immunohistochemistry_7021.jpg)
![Intracellular Staining by Flow Cytometry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Flow_Cytometry_8448.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Publication using NBP1-94168 | Applications | Species |
|---|---|---|
| Zhou H, Jia X, Hu K et al. TMEM2 binds to CSNK2A3 to inhibit HBV infection via activation of the JAK/STAT pathway Experimental cell research 2021-03-01 [PMID: 33582094] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMEM2 |
![Immunocytochemistry/Immunofluorescence: TMEM2 Antibody [NBP1-94168] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining shown in green.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94168-img0006.jpg "Immunocytochemistry/Immunofluorescence: TMEM2 Antibody [NBP1-94168] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human Fallopian tube shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Immunohistochemistry-Paraffin-NBP1-94168-img0019.jpg "Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human Fallopian tube shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Immunohistochemistry-Paraffin-NBP1-94168-img0013.jpg "Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Immunohistochemistry-Paraffin-NBP1-94168-img0014.jpg "Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human small intestine shows moderate positivity in apical membranes in glandular cells.](http://images.novusbio.com/fullsize/TMEM2-Antibody-Immunohistochemistry-Paraffin-NBP1-94168-img0015.jpg "Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human small intestine shows moderate positivity in apical membranes in glandular cells.")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")