Novus Biologicals products are now on bio-techne.com

TIPIN Recombinant Protein Antigen

Name: TIPIN Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83650PEP
Price: 279 USD

Images

There are currently no images for TIPIN Protein (NBP1-83650PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TIPIN Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIPIN. Source: E. coli Amino Acid Sequence: EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TIPIN
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83650. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIPIN Recombinant Protein Antigen

FLJ20516
TIMELESS interacting protein
TIMELESS-interacting protein

Background

Timeless-interacting protein (TIPIN) was originally isolated as a protein that interacts with timeless, a factor that plays a role in circadian rhythm and cell cycle checkpoint regulation. The TIM-TIPIN complex has been shown to coordinate the intra-S-phase checkpoint in response to UV-induced DNA damage. TIPIN is required for cell cycle arrest in response to DNA damage. It also interacts with RPA (replication protein A) on DNA and is able to slow down DNA chain elongation in response to UV-damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Timeless Antibody

NB100-40853

Immunohistochemistry-Paraffin Timeless Antibody

(1 Review)

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, WB

Claspin Antibody

NB100-247

Immunohistochemistry-Paraffin Claspin Antibody

(13 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, WB

TIM-1/KIM-1/HAVCR
Antibody [Unconjugate ...

AF1817

(105 Publications)

Species: Mu

Applications: WB

Chk1 Antibody

NB100-464

Immunohistochemistry-Paraffin Chk1 Antibody

(12 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

ARHGEF5 Antibody

NB100-2559

Immunohistochemistry-Paraffin ARHGEF5 Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

Triosephosphate
isomerase Antibody

NBP1-31470

Immunocytochemistry/ Immunofluorescence Triosephosphate isomerase Antibody

(1 Review)

(11 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

ATR Antibody (2B5)

NB100-308

(21 Publications)

Species: Hu, Mu

Applications: Func, ICC/IF, IP, In vitro, KO, WB

TEM8/ANTXR1
Antibody (200C1339(SB ...

NB100-56585

Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free

(5 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

MMAB Antibody
(OTI2G5)

NBP2-03417

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

MCM7 Antibody (6C2)

H00004176-M01

Proximity Ligation Assay MCM7 Antibody (6C2)

(5 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB

ATM Antibody (2C1)

NB100-309

(3 Reviews)

(131 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

PGAP3 Antibody

NBP3-12196

Species: Hu, Mu, Rt

Applications: DB, ELISA, IHC, IHC-P, IP, WB

PER1 Antibody

NBP2-24589

(1 Review)

(4 Publications)

Species: Bv, Ca, Eq, Hu, Mu, Pm

Applications: IB, IHC, IHC-P, KO, WB

WDHD1 Antibody -
Azide and BSA Free

NBP2-93674

Immunocytochemistry/ Immunofluorescence WDHD1 Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin WDHD1 Antibody - Azide and BSA Free

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PLK1 Antibody
(OTI1D4)

NBP1-48291

Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, IP, WB

SmarcAL1 Antibody

NBP2-20414

Immunocytochemistry/ Immunofluorescence SmarcAL1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IP, WB

CRY1 Antibody
[Unconjugated]

AF3764

Immunohistochemistry CRY1 Antibody [Unconjugated]

(1 Publication)

Species: Hu, Mu

Applications: ICC, IHC, WB

CDC45L Antibody

NBP1-85723

Immunohistochemistry-Paraffin CDC45L Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

MCM4 Antibody

NBP1-33105

Immunohistochemistry-Paraffin MCM4 Antibody

Species: Hu, Mu

Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB

TIPIN Recombinant
Protein Antigen

NBP1-83650PEP

Species: Hu

Applications: AC

Publications for TIPIN Protein (NBP1-83650PEP) (0)

There are no publications for TIPIN Protein (NBP1-83650PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIPIN Protein (NBP1-83650PEP) (0)

There are no reviews for TIPIN Protein (NBP1-83650PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIPIN Protein (NBP1-83650PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIPIN Products

Research Areas for TIPIN Protein (NBP1-83650PEP)

Find related products by research area.

DNA Repair

Blogs on TIPIN

There are no specific blogs for TIPIN, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ATM Antibody (2C1)
NB100-309

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TIPIN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TIPIN

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TIPIN Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TIPIN Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TIPIN Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TIPIN Protein (NBP1-83650PEP) (0)

Reviews for TIPIN Protein (NBP1-83650PEP) (0)

FAQs for TIPIN Protein (NBP1-83650PEP) (0)

Additional TIPIN Products

Research Areas for TIPIN Protein (NBP1-83650PEP)

Blogs on TIPIN

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics