![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human placenta and pancreas tissues. Corresponding TfR (Transferrin R) RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0015.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human placenta and pancreas tissues. Corresponding TfR (Transferrin R) RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV |
| Marker | Recycling Endosome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TFRC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TfR (Transferrin R) Antibody (NBP1-85741)Find related products by research area.
|
|
Transferrin and the blood brain barrier Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TFRC |
![Western Blot: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human cell line HELA.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Western-Blot-NBP1-85741-img0008.jpg "Western Blot: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human cell line HELA.")
![Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cell line U-251 MG shows localization to endosomes and lysosomes. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85741-img0014.jpg "Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cell line U-251 MG shows localization to endosomes and lysosomes. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0019.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0011.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0016.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human lung shows strong cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0017.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human lung shows strong cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/TfR-Transferrin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-85741-img0018.jpg "Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Immunocytochemistry_15894.jpg)
![Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/16242.jpg)
![Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Western_Blot_14193.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")