Home » TCF-3/E2A » E2A Antibodies » TCF-3/E2A Antibody

TCF-3/E2A Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staning is shown in green.
Immunocytochemistry/ Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staning is shown in green.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human lymphoid tissues shows weak to moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human gastrointestinal shows weak to moderate nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals offers 100% Guarantee

TCF-3/E2A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCF-3/E2A Protein (NBP2-38611PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF-3/E2A Antibody

  • bHLHb21
  • bHLHb21TCF-3
  • Class B basic helix-loop-helix protein 21
  • E2A immunoglobulin enhancer-binding factor E12/E47
  • E2A
  • E2AKappa-E2-binding factor
  • Immunoglobulin enhancer-binding factor E12/E47
  • Immunoglobulin transcription factor 1
  • ITF1
  • ITF1Transcription factor ITF-1
  • Kappa-E2-binding factor
  • MGC129647
  • MGC129648
  • Pan2
  • TCF-3
  • Tcfe2a
  • transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
  • Transcription factor 3
  • transcription factor E2-alpha
  • VDIR
  • VDR interacting repressor

Background

TCF3 / E2A encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporatic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TCF7L1/TCF3
Antibody
AF6116
Immunocytochemistry TCF7L1/TCF3 Antibody
Western Blot TCF7L1/TCF3 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
ELSPBP1 Antibody
NBP2-13957
Western Blot ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
TCF-12/HTF4
Antibody (2E9)
H00006938-M01
Immunocytochemistry/ Immunofluorescence TCF-12/HTF4 Antibody (2E9)
Immunohistochemistry-Paraffin TCF-12/HTF4 Antibody (2E9)
Western Blot TCF-12/HTF4 Antibody (2E9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
ID1 Antibody
[Unconjugated]
AF4377
Western Blot ID1 Antibody [Unconjugated]
Immunocytochemistry ID1 Antibody [Unconjugated]
Simple Western ID1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Western Blot MyoD Antibody (5.8A) - BSA Free
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
EBF-1 Antibody
[Unconjugated]
AF5165
Western Blot EBF-1 Antibody [Unconjugated]
Western Blot EBF-1 Antibody [Unconjugated]
Western Blot EBF-1 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: WB
TCF4 Antibody (1G4)
H00006925-M03
ELISA TCF4 Antibody (1G4)
Immunocytochemistry/ Immunofluorescence TCF4 Antibody (1G4)
Western Blot TCF4 Antibody (1G4)
(1 Review)
(8 Publications)
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TCF7L2 Antibody -
BSA Free
NBP1-19083
Western Blot TCF7L2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TCF7L2 Antibody - BSA Free
Western Blot TCF7L2 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Pax5/BSAP Antibody
(1207C) [Unconjugated ...
MAB3487
Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]
Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]
Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
ID3 Antibody
(OTI8B3)
NBP2-02136
Flow Cytometry ID3 Antibody (OTI8B3)
Western Blot ID3 Antibody (OTI8B3)
Flow Cytometry ID3 Antibody (OTI8B3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ID2 Antibody
NBP2-27194
Western Blot ID2 Antibody
Immunocytochemistry/ Immunofluorescence ID2 Antibody
(1 Review)
(2 Publications)
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot LEF1 Antibody (3H5)
Sandwich ELISA LEF1 Antibody (3H5)
Western Blot LEF1 Antibody (3H5)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
HNF-4 alpha/NR2A1
Antibody (K9218) [Unc ...
PP-K9218-00
HNF-4 alpha/NR2A1 Antibody (K9218) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, IP, WB

Publications for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no publications for TCF-3/E2A Antibody (NBP2-38611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no reviews for TCF-3/E2A Antibody (NBP2-38611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF-3/E2A Products

Research Areas for TCF-3/E2A Antibody (NBP2-38611)

Find related products by research area.

Blogs on TCF-3/E2A

There are no specific blogs for TCF-3/E2A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF-3/E2A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TCF3
Uniprot