![Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5 Analysis of LEF1 expression in MES-SA/Dx5.](http://images.novusbio.com/fullsize/LEF1-Antibody-3H5-Western-Blot-H00051176-M01-img0009.jpg "Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5 Analysis of LEF1 expression in MES-SA/Dx5.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, KD |
| Clone | 3H5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LEF1 (AAH50632, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI |
| Specificity | LEF1 - lymphoid enhancer-binding factor 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LEF1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LEF1 Antibody (H00051176-M01)Find related products by research area.
|
|
The role of Wnts in neuroinflammation By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s... Read full blog post. |
|
Beta Catenin in Cell Adhesion and T-cell Signaling Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/LEF1-Antibody-3H5-Western-Blot-H00051176-M01-img0006.jpg "Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.](http://images.novusbio.com/fullsize/LEF1-Antibody-3H5-Western-Blot-H00051176-M01-img0008.jpg "Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.")
![Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.Lane 1: LEF1 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LEF1-Antibody-3H5-Western-Blot-H00051176-M01-img0010.jpg "Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.Lane 1: LEF1 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LEF1-Antibody-3H5-Sandwich-ELISA-H00051176-M01-img0007.jpg "Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.")
![Western Blot TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Western_Blot_14720.jpg)
![Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Flow_Cytometry_14888.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Western_Blot_12841.jpg)
![Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Immunohistochemistry_12859.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")