![Knockdown Validated: Synaptojanin 1 Antibody [NBP1-87842] - (A) The levels of synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls +/- SEM. (B) A representative example of western blot analysis. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-017-11654-7) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Knockdown-Validated-NBP1-87842-img0023.jpg "Knockdown Validated: Synaptojanin 1 Antibody [NBP1-87842] - (A) The levels of synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls +/- SEM. (B) A representative example of western blot analysis. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-017-11654-7) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYNJ1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Western_Blot_16272.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16281.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16416.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Synaptojanin 1 Antibody (NBP1-87842)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYNJ1 |
![Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87842-img0016.jpg "Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the same tissues.")
![Immunocytochemistry/Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87842-img0022.jpg "Immunocytochemistry/Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87842-img0020.jpg "Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebellum shows moderate positivity in neuropil as well as in a subset of neurons.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87842-img0017.jpg "Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebellum shows moderate positivity in neuropil as well as in a subset of neurons.")
![Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebral cortex shows positivity in neuropil as well as moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87842-img0018.jpg "Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebral cortex shows positivity in neuropil as well as moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human rectum shows moderate cytoplasmic positivity in neurons in peripheral ganglia.](http://images.novusbio.com/fullsize/Synaptojanin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87842-img0019.jpg "Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human rectum shows moderate cytoplasmic positivity in neurons in peripheral ganglia.")
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")