![Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Analysis in human cerebral cortex and small intestine tissues using HPA007863 antibody. Corresponding SV2A RNA-seq dat](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunohistochemistry-Paraffin-NBP1-82964-img0021.jpg "Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Analysis in human cerebral cortex and small intestine tissues using HPA007863 antibody. Corresponding SV2A RNA-seq dat")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SV2A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Jennifer Fox |
WB | Human and Mouse | 01/28/2015 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
IP | Human | 01/28/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Jennifer Fox 01/28/2015 |
||
| Application: | WB | |
| Species: | Human and Mouse |
| Verified Customer 01/28/2015 |
||
| Application: | IP | |
| Species: | Human |
| Gene Symbol | SV2A |
![Immunocytochemistry/Immunofluorescence: SV2A Antibody [NBP1-82964] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82964-img0016.jpg "Immunocytochemistry/Immunofluorescence: SV2A Antibody [NBP1-82964] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human small intestine shows no positivity in glandular cells.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunohistochemistry-Paraffin-NBP1-82964-img0024.jpg "Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human small intestine shows no positivity in glandular cells.")
![Western Blot: SV2A Antibody [NBP1-82964] - Analysis of SV2A in (1) undifferentiated SH-SY5Y, (2) differentiated SH-SY5Y (neurons) and (3) mouse brain using anti-SV2A antibody. 30ug of protein/lane. Image from verified customer review.](http://images.novusbio.com/fullsize/SV2A-Antibody-Western-Blot-NBP1-82964-img0007.jpg "Western Blot: SV2A Antibody [NBP1-82964] - Analysis of SV2A in (1) undifferentiated SH-SY5Y, (2) differentiated SH-SY5Y (neurons) and (3) mouse brain using anti-SV2A antibody. 30ug of protein/lane. Image from verified customer review.")
![Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunohistochemistry-Paraffin-NBP1-82964-img0020.jpg "Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.")
![Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebellum shows strong cytoplasmic positivity in neuropil.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunohistochemistry-Paraffin-NBP1-82964-img0022.jpg "Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebellum shows strong cytoplasmic positivity in neuropil.")
![Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunohistochemistry-Paraffin-NBP1-82964-img0023.jpg "Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunoprecipitation: SV2A Antibody [NBP1-82964] - Staining of neuroblastoma cells SH-SY5Y differentiated into neurons. Lane (1) 10ug of input, 500ug used for IP. 10ul of antibody used for incubation with lysate (overnight incubation at 4C with rotation) prior to addition of beads. Image from verified customer review.](http://images.novusbio.com/fullsize/SV2A-Antibody-Immunoprecipitation-NBP1-82964-img0006.jpg "Immunoprecipitation: SV2A Antibody [NBP1-82964] - Staining of neuroblastoma cells SH-SY5Y differentiated into neurons. Lane (1) 10ug of input, 500ug used for IP. 10ul of antibody used for incubation with lysate (overnight incubation at 4C with rotation) prior to addition of beads. Image from verified customer review.")
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
