Novus Biologicals products are now on bio-techne.com

Suppressor of Fused Recombinant Protein Antigen

Images

 
There are currently no images for Suppressor of Fused Protein (NBP1-87384PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Suppressor of Fused Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUFU.

Source: E. coli

Amino Acid Sequence: TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUFU
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87384.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Suppressor of Fused Recombinant Protein Antigen

  • SUFUHSUFUXLPRO1280
  • suppressor of fused homolog (Drosophila)
  • suppressor of fused homolog

Background

The Hedgehog (Hh) signaling pathway has conserved roles in development of species ranging from Drosophila to humans. Human supressor of fused HSu(Fu) acts as a negative regulator in the hedgehog signaling (SHH) pathway by down-regulating GLI1-mediated transactivation of target genes (1). HSu(fu) was found to repress activity of the zinc-finger transcription factor Gli, which mediates Hedgehog signaling in vertebrates, and to physically interact with Gli, Gli2 and Gli3 (2). The sonic hedgehog signaling pathway directs the embryonic development of diverse organisms and is disrupted in a variety of malignancies. Several of mutations encode truncated proteins that are unable to export the GLI transcription factor from nucleus to cytoplasm, resulting in the activation of SHH signaling. SUFU is a newly identified tumor-suppressor gene that predisposes individuals to medulloblastoma by modulating the SHH signaling pathway through a newly identified mechanism (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP3-35576
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
MAB41051
Species: Hu, Mu
Applications: IHC, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
AF1705
Species: Mu
Applications: IHC, WB
AF1568
Species: Mu
Applications: WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: IHC, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Suppressor of Fused Protein (NBP1-87384PEP) (0)

There are no publications for Suppressor of Fused Protein (NBP1-87384PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Suppressor of Fused Protein (NBP1-87384PEP) (0)

There are no reviews for Suppressor of Fused Protein (NBP1-87384PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Suppressor of Fused Protein (NBP1-87384PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Suppressor of Fused Products

Research Areas for Suppressor of Fused Protein (NBP1-87384PEP)

Find related products by research area.

Blogs on Suppressor of Fused

There are no specific blogs for Suppressor of Fused, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Suppressor of Fused Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUFU