![Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/STK39-Antibody-Immunohistochemistry-Paraffin-NBP2-49373-img0003.jpg "Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human liver shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STK39 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry AATK/Serine/threonine-protein kinase LMTK1 Antibody (456006) [Unconjugated]](https://images.novusbio.com/images2/AATK_MAB4866_Flow_Cytometry_8507.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for STK39 Antibody (NBP2-49373)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STK39 |
![Immunohistochemistry: STK39 Antibody [NBP2-49373] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in granular layer.](http://images.novusbio.com/fullsize/STK39-Antibody-Immunohistochemistry-NBP2-49373-img0001.jpg "Immunohistochemistry: STK39 Antibody [NBP2-49373] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in granular layer.")
![Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/STK39-Antibody-Immunohistochemistry-Paraffin-NBP2-49373-img0002.jpg "Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining in human cerebral cortex and liver tissues using anti-STK39 antibody. Corresponding STK39 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/STK39-Antibody-Immunohistochemistry-Paraffin-NBP2-49373-img0004.jpg "Immunohistochemistry-Paraffin: STK39 Antibody [NBP2-49373] - Staining in human cerebral cortex and liver tissues using anti-STK39 antibody. Corresponding STK39 RNA-seq data are presented for the same tissues.")
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")