![Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in human cell lines A-549 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/STIM1-Antibody-Western-Blot-NBP1-84322-img0012.jpg "Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in human cell lines A-549 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STIM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 24621671). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-84322 | Applications | Species |
|---|---|---|
| Wang S, Choi M, Richardson AS et al. STIM1 and SLC24A4 Are Critical for Enamel Maturation. J Dent Res 2014-07-01 [PMID: 24621671] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for STIM1 Antibody (NBP1-84322)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STIM1 |
![Immunocytochemistry/Immunofluorescence: STIM1 Antibody [NBP1-84322] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84322-img0010.jpg "Immunocytochemistry/Immunofluorescence: STIM1 Antibody [NBP1-84322] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0021.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/STIM1-Antibody-Western-Blot-NBP1-84322-img0007.jpg "Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0013.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts..](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0014.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts..")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0015.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0016.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0019.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-STIM1 antibody NBP1-84322 (A) shows similar protein distribution across tissues to independent antibody NBP1-84323 (B).](http://images.novusbio.com/fullsize/STIM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84322-img0020.jpg "Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-STIM1 antibody NBP1-84322 (A) shows similar protein distribution across tissues to independent antibody NBP1-84323 (B).")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")