Home » STAM-1 » STAM-1 Proteins » STAM-1 Recombinant Protein Antigen

STAM-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for STAM-1 Protein (NBP2-38514PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

STAM-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAM.

Source: E. coli

Amino Acid Sequence: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STAM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38514.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STAM-1 Recombinant Protein Antigen

  • DKFZp686J2352
  • HSE1 Homolog
  • signal transducing adapter molecule 1
  • signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
  • STAM
  • STAM1
  • STAM-1
  • STAM1STAM-1

Background

STAM was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HGS Antibody (6D11)
H00009146-M01
Immunocytochemistry/ Immunofluorescence HGS Antibody (6D11)
Western Blot HGS Antibody (6D11)
Sandwich ELISA HGS Antibody (6D11)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
SFRS5 Antibody
H00006430-B01P
Immunohistochemistry SFRS5 Antibody
Immunocytochemistry/ Immunofluorescence SFRS5 Antibody
Immunohistochemistry-Paraffin SFRS5 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HARS Antibody
NBP1-89490
Immunocytochemistry/ Immunofluorescence HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
STAM2 Antibody
NBP1-83289
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
AMSH/STAMBP
Antibody [Unconjugate
AF5650
Western Blot AMSH/STAMBP Antibody [Unconjugated]
Immunohistochemistry AMSH/STAMBP Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(379 Publications)
Species: Hu
Applications: BA
TOM1 Antibody
NBP1-86170
Western Blot TOM1 Antibody
Immunohistochemistry-Paraffin TOM1 Antibody
Immunohistochemistry-Paraffin TOM1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
UCH-L3 Antibody
NBP1-86037
Immunocytochemistry/ Immunofluorescence UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(48 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(861 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
UBPY/USP8 Antibody
NBP2-20792
Immunoprecipitation UBPY/USP8 Antibody
Immunocytochemistry/ Immunofluorescence UBPY/USP8 Antibody
Western Blot UBPY/USP8 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Jak3 Antibody
(5H2) - BSA Free
NBP2-37737
Western Blot Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
SNAP25 Antibody
NBP1-33714
Immunohistochemistry-Paraffin SNAP25 Antibody
Immunohistochemistry-Paraffin SNAP25 Antibody
Immunohistochemistry-Frozen SNAP25 Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for STAM-1 Protein (NBP2-38514PEP) (0)

There are no publications for STAM-1 Protein (NBP2-38514PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAM-1 Protein (NBP2-38514PEP) (0)

There are no reviews for STAM-1 Protein (NBP2-38514PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STAM-1 Protein (NBP2-38514PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STAM-1 Products

Research Areas for STAM-1 Protein (NBP2-38514PEP)

Find related products by research area.

Blogs on STAM-1

There are no specific blogs for STAM-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STAM-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol STAM