![Western Blot: SRp55 Antibody [NBP1-90043] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/SRp55-Antibody-Western-Blot-NBP1-90043-img0013.jpg "Western Blot: SRp55 Antibody [NBP1-90043] - Analysis in human cell line MOLT-4.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRSF6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRSF6 |
![Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SRp55-Antibody-Immunohistochemistry-Paraffin-NBP1-90043-img0019.jpg "Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.")
![Western Blot: SRp55 Antibody [NBP1-90043] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SRp55-Antibody-Western-Blot-NBP1-90043-img0008.jpg "Western Blot: SRp55 Antibody [NBP1-90043] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SRp55-Antibody-Immunohistochemistry-Paraffin-NBP1-90043-img0015.jpg "Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/SRp55-Antibody-Immunohistochemistry-Paraffin-NBP1-90043-img0016.jpg "Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human tonsil shows moderate to strong nuclear positivity.](http://images.novusbio.com/fullsize/SRp55-Antibody-Immunohistochemistry-Paraffin-NBP1-90043-img0017.jpg "Immunohistochemistry-Paraffin: SRp55 Antibody [NBP1-90043] - Staining of human tonsil shows moderate to strong nuclear positivity.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")