Orthogonal Strategies: Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining in human liver and pancreas tissues . Corresponding SOD1 RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SOD1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.
Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Simple Western lane view shows a specific band for SOD1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing ...read more
Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Electropherogram image(s) of corresponding Simple Western lane view. SOD1/Cu-Zn SOD antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).
This antibody was developed against Recombinant Protein corresponding to amino acids: PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF PFA/Triton X-100.. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for SOD1/Cu-Zn SOD Antibody (NBP1-90186) (0)
There are no reviews for SOD1/Cu-Zn SOD Antibody (NBP1-90186).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SOD1/Cu-Zn SOD Antibody and receive a gift card or discount.