![Western Blot: SLCO1A2 Antibody [NBP2-85770] - WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateSLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells](http://images.novusbio.com/fullsize/SLCO1A2-Antibody-Western-Blot-NBP2-85770-img0002.jpg "Western Blot: SLCO1A2 Antibody [NBP2-85770] - WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateSLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2. Peptide sequence: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLCO1A2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLCO1A2 Antibody (NBP2-85770)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLCO1A2 |
![Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770] - Rabbit Anti-SLCO1A2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane, Cytoplasm in hepatocytes, very strong, moderate tissue distribution. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 -2.0 sec.](http://images.novusbio.com/fullsize/SLCO1A2-Antibody-Immunohistochemistry-Paraffin-NBP2-85770-img0001.jpg "Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770] - Rabbit Anti-SLCO1A2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane, Cytoplasm in hepatocytes, very strong, moderate tissue distribution. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 -2.0 sec.")
![Western Blot: SLCO1A2 Antibody [NBP2-85770] - Host: Rabbit. Target Name: SLCO1A2. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/SLCO1A2-Antibody-Western-Blot-NBP2-85770-img0003.jpg "Western Blot: SLCO1A2 Antibody [NBP2-85770] - Host: Rabbit. Target Name: SLCO1A2. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
