SLC7A8 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC7A8 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for SLC7A8 Antibody
Background
Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Publications for SLC7A8 Antibody (NBP2-49319) (0)
There are no publications for SLC7A8 Antibody (NBP2-49319).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC7A8 Antibody (NBP2-49319) (0)
There are no reviews for SLC7A8 Antibody (NBP2-49319).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SLC7A8 Antibody (NBP2-49319) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC7A8 Products
Research Areas for SLC7A8 Antibody (NBP2-49319)
Find related products by research area.
|
Blogs on SLC7A8