![Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining in human kidney and prostate tissues using anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC7A7-Antibody-Immunohistochemistry-Paraffin-NBP1-82826-img0008.jpg "Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining in human kidney and prostate tissues using anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC7A7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC7A7 |
![Western Blot: SLC7A7 Antibody [NBP1-82826] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SLC7A7-Antibody-Western-Blot-NBP1-82826-img0009.jpg "Western Blot: SLC7A7 Antibody [NBP1-82826] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/SLC7A7-Antibody-Immunohistochemistry-Paraffin-NBP1-82826-img0006.jpg "Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/SLC7A7-Antibody-Immunohistochemistry-Paraffin-NBP1-82826-img0007.jpg "Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human prostate shows low expression as expected.")
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")