SLC37A4 Antibody (7B9) Summary
Immunogen |
SLC37A4 (NP_001458.1, 28 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SLC37A4 |
Purity |
Protein A or G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SLC37A4 Antibody (7B9)
Background
The SLC37A4 gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, inorder to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of theendoplasmic reticulum. M
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ELISA
Publications for SLC37A4 Antibody (H00002542-M01-100ug) (0)
There are no publications for SLC37A4 Antibody (H00002542-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC37A4 Antibody (H00002542-M01-100ug) (0)
There are no reviews for SLC37A4 Antibody (H00002542-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC37A4 Antibody (H00002542-M01-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC37A4 Products
Array H00002542-M01-100ug
Blogs on SLC37A4