Home » SLC22A3 » SLC22A3 Proteins » SLC22A3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC22A3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC22A3 Protein (NBP1-83976PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC22A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC22A3.

Source: E. coli

Amino Acid Sequence: SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC22A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83976.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC22A3 Recombinant Protein Antigen

  • EMTEMTH
  • EMTH
  • Extraneuronal monoamine transporter
  • OCT3
  • OCT3EMT organic cation transporter 3
  • Organic cation transporter 3
  • SLC22A3
  • solute carrier family 22 (extraneuronal monoamine transporter), member 3
  • solute carrier family 22 member 3

Background

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Slug Antibody
(OTI1A6)
NBP2-03886
Flow Cytometry Slug Antibody (OTI1A6)
Western Blot Slug Antibody (OTI1A6)
Immunohistochemistry-Paraffin Slug Antibody (OTI1A6)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Twist-1 Antibody
(10E4E6) - BSA Free
NBP2-37364
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
Flow (Intracellular) Twist-1 Antibody (10E4E6) - BSA Free
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
ZEB1 Antibody
NBP1-05987
Immunoprecipitation ZEB1 Antibody
Western Blot ZEB1 Antibody
Immunohistochemistry-Paraffin ZEB1 Antibody
(6 Reviews)
(98 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(310 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9)
Flow Cytometry N-Cadherin Antibody (13A9)
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9)
(2 Reviews)
(42 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
SLC22A1 Antibody
(2C5) - BSA Free
NBP1-51684
Flow Cytometry SLC22A1 Antibody (2C5) - BSA Free
Western Blot SLC22A1 Antibody (2C5) - BSA Free
(11 Publications)
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
ZEB2 Antibody
NBP1-82991
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
(2 Reviews)
(29 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

Publications for SLC22A3 Protein (NBP1-83976PEP) (0)

There are no publications for SLC22A3 Protein (NBP1-83976PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A3 Protein (NBP1-83976PEP) (0)

There are no reviews for SLC22A3 Protein (NBP1-83976PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC22A3 Protein (NBP1-83976PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC22A3 Products

Array NBP1-83976PEP

Blogs on SLC22A3

There are no specific blogs for SLC22A3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC22A3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC22A3