Home » SLC22A3 » SLC22A3 Proteins » Recombinant Human SLC22A3 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SLC22A3 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related SLC22A3 Peptides and Proteins

Order Details


    • Catalog Number
      H00006581-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SLC22A3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 90-155 of Human SLC22A3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC22A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC22A3 GST (N-Term) Protein

  • EMTEMTH
  • EMTH
  • Extraneuronal monoamine transporter
  • OCT3
  • OCT3EMT organic cation transporter 3
  • Organic cation transporter 3
  • SLC22A3
  • solute carrier family 22 (extraneuronal monoamine transporter), member 3
  • solute carrier family 22 member 3

Background

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(136 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Slug Antibody
(OTI1A6)
NBP2-03886
Flow Cytometry Slug Antibody (OTI1A6)
Western Blot Slug Antibody (OTI1A6)
Immunohistochemistry-Paraffin Slug Antibody (OTI1A6)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Twist-1 Antibody
(10E4E6) - BSA Free
NBP2-37364
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
Flow (Intracellular) Twist-1 Antibody (10E4E6) - BSA Free
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(73 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(353 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
ZEB1 Antibody
NBP1-05987
Immunoprecipitation ZEB1 Antibody
Western Blot ZEB1 Antibody
Immunohistochemistry-Paraffin ZEB1 Antibody
(6 Reviews)
(97 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(298 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9)
Flow Cytometry N-Cadherin Antibody (13A9)
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9)
(2 Reviews)
(41 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
SLC22A1 Antibody
(2C5) - BSA Free
NBP1-51684
Flow Cytometry SLC22A1 Antibody (2C5) - BSA Free
Western Blot SLC22A1 Antibody (2C5) - BSA Free
(10 Publications)
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
ZEB2 Antibody
NBP1-82991
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
(2 Reviews)
(28 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

Publications for SLC22A3 Partial Recombinant Protein (H00006581-Q01) (0)

There are no publications for SLC22A3 Partial Recombinant Protein (H00006581-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A3 Partial Recombinant Protein (H00006581-Q01) (0)

There are no reviews for SLC22A3 Partial Recombinant Protein (H00006581-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A3 Partial Recombinant Protein (H00006581-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC22A3 Products

Array H00006581-Q01

Blogs on SLC22A3

There are no specific blogs for SLC22A3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC22A3 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC22A3