![Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SLC1A7-Antibody-Immunohistochemistry-Paraffin-NBP2-13317-img0007.jpg "Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC1A7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC1A7 Antibody (NBP2-13317)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC1A7 |
![Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human eye, retina shows weak granular cytoplasmic positivity in nerve fibers in plexiform layers.](http://images.novusbio.com/fullsize/SLC1A7-Antibody-Immunohistochemistry-Paraffin-NBP2-13317-img0004.jpg "Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human eye, retina shows weak granular cytoplasmic positivity in nerve fibers in plexiform layers.")
![Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/SLC1A7-Antibody-Immunohistochemistry-Paraffin-NBP2-13317-img0005.jpg "Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human rectum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC1A7-Antibody-Immunohistochemistry-Paraffin-NBP2-13317-img0006.jpg "Immunohistochemistry-Paraffin: SLC1A7 Antibody [NBP2-13317] - Staining of human rectum shows no positivity in glandular cells as expected.")
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")