![Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Analysis in human kidney and liver tissues using NBP1-86376 antibody. Corresponding SLC12A3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC12A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86376-img0009.jpg "Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Analysis in human kidney and liver tissues using NBP1-86376 antibody. Corresponding SLC12A3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS |
| Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC12A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-86376 | Applications | Species |
|---|---|---|
| Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550] |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC12A3 Antibody (NBP1-86376)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC12A3 |
![Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/SLC12A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86376-img0012.jpg "Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/SLC12A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86376-img0006.jpg "Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC12A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86376-img0010.jpg "Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC12A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86376-img0011.jpg "Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")