![Western Blot: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Western blot analysis of extracts of various cell lines, using SFRS3 Rabbit mAb (NBP3-16741) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/SFRS3-Antibody-9A1Z4-Western-Blot-NBP3-16741-img0004.jpg "Western Blot: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Western blot analysis of extracts of various cell lines, using SFRS3 Rabbit mAb (NBP3-16741) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 9A1Z4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRS3 (P84103). MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRP |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SRSF3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRSF3 |
![Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded mouse colon tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16741_rabbit-sfrs3-mab-9a1z4-822025209886.jpg "Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded mouse colon tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded rat kidney tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16741_rabbit-sfrs3-mab-9a1z4-822025208463.jpg "Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded rat kidney tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded rat spleen tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16741_rabbit-sfrs3-mab-9a1z4-822025209883.jpg "Immunohistochemistry: SFRS3 Antibody (9A1Z4) [NBP3-16741] - Immunohistochemistry analysis of SFRS3 in paraffin-embedded rat spleen tissue using SFRS3 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")