Serotonin N-acetyltransferase Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AANAT |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Serotonin N-acetyltransferase Antibody
Background
Arylalkylamine N-Acetyltransferase (AANAT) is the main enzyme for melatonin synthesis. Hormonal melatonin has been implicated in sleep and circadian clock function, and acts as"the hormone of the night." Large changes in the abundance of AANAT are believed to be responsible for the large day/night rhythms in melatonin synthesis in the pineal gland and retina. Most research shows that AANAT activity is regulated by controlling the steady-state levels of the protein. Recent research, however, suggests that another mechanism may also play a role in controlling melatonin production without altering AANAT protein and activity. This mechanism may explain the sudden physiological increase in circulating melatonin observed at the onset of the dark period in humans.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF
Publications for Serotonin N-acetyltransferase Antibody (NBP2-55364) (0)
There are no publications for Serotonin N-acetyltransferase Antibody (NBP2-55364).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Serotonin N-acetyltransferase Antibody (NBP2-55364) (0)
There are no reviews for Serotonin N-acetyltransferase Antibody (NBP2-55364).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Serotonin N-acetyltransferase Antibody (NBP2-55364) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Serotonin N-acetyltransferase Products
Research Areas for Serotonin N-acetyltransferase Antibody (NBP2-55364)
Find related products by research area.
|
Blogs on Serotonin N-acetyltransferase