![Immunocytochemistry/Immunofluorescence: SAP30 Antibody (4D2) [H00008819-M02] - Analysis of monoclonal antibody to SAP30 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/SAP30-Antibody-4D2-Immunocytochemistry-Immunofluorescence-H00008819-M02-img0004.jpg "Immunocytochemistry/Immunofluorescence: SAP30 Antibody (4D2) [H00008819-M02] - Analysis of monoclonal antibody to SAP30 on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4D2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV |
| Specificity | SAP30 (4D2) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SAP30 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SAP30 Antibody (4D2) [H00008819-M02] - Analysis of monoclonal antibody to SAP30 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize/SAP30-Antibody-4D2-Immunohistochemistry-Paraffin-H00008819-M02-img0006.jpg "Immunohistochemistry-Paraffin: SAP30 Antibody (4D2) [H00008819-M02] - Analysis of monoclonal antibody to SAP30 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.5 ug/ml.")
![ELISA: SAP30 Antibody (4D2) [H00008819-M02] - Detection limit for recombinant GST tagged SAP30 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SAP30-Antibody-4D2-ELISA-H00008819-M02-img0008.jpg "ELISA: SAP30 Antibody (4D2) [H00008819-M02] - Detection limit for recombinant GST tagged SAP30 is approximately 1ng/ml as a capture antibody.")
