![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0011.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SAMD9L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SAMD9L |
![Immunohistochemistry: SAMD9L Antibody [NBP1-91243] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-NBP1-91243-img0002.jpg "Immunohistochemistry: SAMD9L Antibody [NBP1-91243] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0004.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human kidney.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0006.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0007.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node, placenta, stomach and testis using Anti-SAMD9L antibody NBP1-91243 (A) shows similar protein distribution across tissues to independent antibody NBP1-91242 (B).](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0008.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human lymph node, placenta, stomach and testis using Anti-SAMD9L antibody NBP1-91243 (A) shows similar protein distribution across tissues to independent antibody NBP1-91242 (B).")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0009.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SAMD9L-Antibody-Immunohistochemistry-Paraffin-NBP1-91243-img0010.jpg "Immunohistochemistry-Paraffin: SAMD9L Antibody [NBP1-91243] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")