Home » S5a/Angiocidin » S5a/Angiocidin Proteins » S5a/Angiocidin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

S5a/Angiocidin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Proteasome 19S S5A Protein (NBP1-90821PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

S5a/Angiocidin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMD4.

Source: E. coli

Amino Acid Sequence: VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90821.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S5a/Angiocidin Recombinant Protein Antigen

  • 26S proteasome non-ATPase regulatory subunit 4;AF;AF-1;ASF;MCB1;PSMD4;pUB-R5;Rpn10;S5A
  • Angiocidin
  • ASF
  • Macropain
  • Mcb1
  • PSMD4
  • pUB-R5
  • Rpn10
  • S5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot gamma-Synuclein Antibody
Immunohistochemistry-Paraffin gamma-Synuclein Antibody
Immunohistochemistry gamma-Synuclein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
SC35 Antibody
NBP2-47290
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
RNPS1 Antibody
(7G8)
H00010921-M05
Western Blot RNPS1 Antibody (7G8)
Western Blot RNPS1 Antibody (7G8)
Western Blot RNPS1 Antibody (7G8)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
hnRNP A1 Antibody
(4B10) - BSA Free
NB100-672
Western Blot hnRNP A1 Antibody (4B10) - BSA Free
Knockdown Validated hnRNP A1 Antibody (4B10) - BSA Free
Knockout Validated hnRNP A1 Antibody (4B10) - BSA Free
(23 Publications)
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
NCOA2 Antibody
NB100-1756
Immunohistochemistry NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
S5a/Angiocidin
Recombinant Protein A ...
NBP1-90821PEP
S5a/Angiocidin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Proteasome 19S S5A Protein (NBP1-90821PEP) (0)

There are no publications for Proteasome 19S S5A Protein (NBP1-90821PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S5A Protein (NBP1-90821PEP) (0)

There are no reviews for Proteasome 19S S5A Protein (NBP1-90821PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome 19S S5A Protein (NBP1-90821PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S5a/Angiocidin Products

Research Areas for Proteasome 19S S5A Protein (NBP1-90821PEP)

Find related products by research area.

Blogs on S5a/Angiocidin

There are no specific blogs for S5a/Angiocidin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S5a/Angiocidin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PSMD4