![ELISA: RRP4 Antibody (4B6) [H00023404-M06] - Detection limit for recombinant GST tagged EXOSC2 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RRP4-Antibody-4B6-ELISA-H00023404-M06-img0001.jpg "ELISA: RRP4 Antibody (4B6) [H00023404-M06] - Detection limit for recombinant GST tagged EXOSC2 is approximately 0.1ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA |
| Clone | 4B6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS |
| Specificity | EXOSC2 (4B6) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | EXOSC2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
