![Western Blot: RPA70 Antibody (5R7S3) [NBP3-16174] - Western blot analysis of extracts of various cell lines, using RPA70 Rabbit mAb (NBP3-16174) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/RPA70-Antibody-5R7S3-Western-Blot-NBP3-16174-img0001.jpg "Western Blot: RPA70 Antibody (5R7S3) [NBP3-16174] - Western blot analysis of extracts of various cell lines, using RPA70 Rabbit mAb (NBP3-16174) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IP, ChIP |
| Clone | 5R7S3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70 (P27694). MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RPA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry/ Immunofluorescence RPA2 [p Ser4, p Ser8] Antibody](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-23017-img0046.jpg)
![Western Blot RPA2 [p Ser4, p Ser8] Antibody](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Western-Blot-NBP1-23017-img0047.jpg)
![Immunoprecipitation RPA2 [p Ser4, p Ser8] Antibody](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Immunoprecipitation-NBP1-23017-img0048.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RPA70 Antibody (NBP3-16174)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPA1 |
![Immunoprecipitation: RPA70 Antibody (5R7S3) [NBP3-16174] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug RPA70 antibody (NBP3-16174). Western blot was performed from the immunoprecipitate using RPA70 antibody (NBP3-16174) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/RPA70-Antibody-5R7S3-Immunoprecipitation-NBP3-16174-img0002.jpg "Immunoprecipitation: RPA70 Antibody (5R7S3) [NBP3-16174] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug RPA70 antibody (NBP3-16174). Western blot was performed from the immunoprecipitate using RPA70 antibody (NBP3-16174) at a dilition of 1:1000.")
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")