![Western Blot: ROCK2 Antibody (1E12) [H00009475-M02] - ROCK2 monoclonal antibody (M02), clone 1E12 Analysis of ROCK2 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/ROCK2-Antibody-1E12-Western-Blot-H00009475-M02-img0009.jpg "Western Blot: ROCK2 Antibody (1E12) [H00009475-M02] - ROCK2 monoclonal antibody (M02), clone 1E12 Analysis of ROCK2 expression in Hela S3 NE.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 1E12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS |
| Specificity | ROCK2 (1E12) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ROCK2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, ELISA and immunohistochemistry (paraffin). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ROCK2 Antibody (H00009475-M02)Find related products by research area.
|
|
TGF-beta for treating degenerative intervertebral disc disease By Jamshed Arslan Pharm.D. Our upright posture and balance depend on a jelly-like material, called nucleus pulposus (NP), in the middle of intervertebral discs. NP cells protect us from disc degeneration by maintain... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ROCK2 Antibody (1E12) [H00009475-M02] - Analysis of monoclonal antibody to ROCK2 on HeLa cell. Antibody concentration 30 ug/ml.](http://images.novusbio.com/fullsize/ROCK2-Antibody-1E12-Immunocytochemistry-Immunofluorescence-H00009475-M02-img0005.jpg "Immunocytochemistry/Immunofluorescence: ROCK2 Antibody (1E12) [H00009475-M02] - Analysis of monoclonal antibody to ROCK2 on HeLa cell. Antibody concentration 30 ug/ml.")
![Immunohistochemistry-Paraffin: ROCK2 Antibody (1E12) [H00009475-M02] - Analysis of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize/ROCK2-Antibody-1E12-Immunohistochemistry-Paraffin-H00009475-M02-img0007.jpg "Immunohistochemistry-Paraffin: ROCK2 Antibody (1E12) [H00009475-M02] - Analysis of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.")
![Sandwich ELISA: ROCK2 Antibody (1E12) [H00009475-M02] - Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ROCK2-Antibody-1E12-Sandwich-ELISA-H00009475-M02-img0008.jpg "Sandwich ELISA: ROCK2 Antibody (1E12) [H00009475-M02] - Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")