![Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Anti-ROBO1 and anti-ROBO2 (NBP1-81399) staining in the corresponding KO embryos, showing the specificity of the antibodies. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31392959/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-NBP1-81399-img0017.jpg "Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Anti-ROBO1 and anti-ROBO2 (NBP1-81399) staining in the corresponding KO embryos, showing the specificity of the antibodies. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31392959/) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, Rt, PmSpecies Glossary |
| Applications | ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant ROBO2 Protein corresponding to amino acids: PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ROBO2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ROBO2 |
![Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-Paraffin-NBP1-81399-img0012.jpg "Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.")
![Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human kidney shows negative to very weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-Paraffin-NBP1-81399-img0013.jpg "Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human kidney shows negative to very weak cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-Paraffin-NBP1-81399-img0014.jpg "Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-Paraffin-NBP1-81399-img0015.jpg "Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of mouse embryo E14 shows strong positivity in developing olfactory bulb and olfactory nerve.](http://images.novusbio.com/fullsize/ROBO2-Antibody-Immunohistochemistry-Paraffin-NBP1-81399-img0016.jpg "Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of mouse embryo E14 shows strong positivity in developing olfactory bulb and olfactory nerve.")
![Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Lateral positioning of ROBO1-expressing longitudinal axons in Nova1/2 dKO embryos.(A) Anti-ROBO1 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO1 was expressed at a low level on precrossing axons & was highly upregulated on postcrossing axons in both WT & Nova1/2 dKO embryos. ROBO1-expressing axons displayed the same lateral positioning defect as anti-L1 labeled axons (compare with Figure 4B). Reducing Robo1(e6b+) partially rescued the lateral positioning defect in Nova1/2 dKO embryos, while reducing Robo2(e6b+) alone did not rescue. Reducing Robo1/2(e6b+) together further rescued the defect. Arrows indicate the lateral funiculus (LF) & ventral funiculus (VF). Scale bar, 50 μm. (B) Quantification of the lateral positioning of ROBO1-expressing axons in A. Data are represented as the mean ± SD (one-way ANOVA & Bonferroni post test; animal numbers & p values are indicated; ns, not significant). (C) Anti-ROBO2 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO2 was primarily expressed by axons in the lateral funiculi, & the overall patterns were comparable between the WT & Nova1/2 dKO embryos. (D) Anti-ROBO1 & anti-ROBO2 staining in the corresponding KO embryos, showing the specificity of the antibodies. The Robo1 KO was generated by trapping the protein product in intracellular compartments (Friedel et al., 2005). ROBO1 expression was seen in neuronal cell bodies but not in axons in Robo1 KO spinal cords, as previously reported (Long et al., 2004). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31392959), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81399_rabbit-polyclonal-robo2-antibody-310202416121910.jpg "Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Lateral positioning of ROBO1-expressing longitudinal axons in Nova1/2 dKO embryos.(A) Anti-ROBO1 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO1 was expressed at a low level on precrossing axons & was highly upregulated on postcrossing axons in both WT & Nova1/2 dKO embryos. ROBO1-expressing axons displayed the same lateral positioning defect as anti-L1 labeled axons (compare with Figure 4B). Reducing Robo1(e6b+) partially rescued the lateral positioning defect in Nova1/2 dKO embryos, while reducing Robo2(e6b+) alone did not rescue. Reducing Robo1/2(e6b+) together further rescued the defect. Arrows indicate the lateral funiculus (LF) & ventral funiculus (VF). Scale bar, 50 μm. (B) Quantification of the lateral positioning of ROBO1-expressing axons in A. Data are represented as the mean ± SD (one-way ANOVA & Bonferroni post test; animal numbers & p values are indicated; ns, not significant). (C) Anti-ROBO2 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO2 was primarily expressed by axons in the lateral funiculi, & the overall patterns were comparable between the WT & Nova1/2 dKO embryos. (D) Anti-ROBO1 & anti-ROBO2 staining in the corresponding KO embryos, showing the specificity of the antibodies. The Robo1 KO was generated by trapping the protein product in intracellular compartments (Friedel et al., 2005). ROBO1 expression was seen in neuronal cell bodies but not in axons in Robo1 KO spinal cords, as previously reported (Long et al., 2004). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31392959), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE Netrin-1 [Unconjugated]](https://images.novusbio.com/images2/Netrin-1_1109-N1_779.jpg)
![Immunohistochemistry DCC Antibody [Unconjugated]](https://images.novusbio.com/images2/af844_mouse-dcc-affinity-purified-polyclonal-ab-immunohistochemistry-21102022151713.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Netrin-G1a Antibody [Unconjugated]](https://images.novusbio.com/images/af1166_mouse-netrin-g1a-affinity-purified-polyclonal-ab-8220249503212.jpg)
![Immunohistochemistry Netrin-G1a Antibody [Unconjugated]](https://images.novusbio.com/images/af1166_mouse-netrin-g1a-affinity-purified-polyclonal-ab-8220249503271.jpg)
![Immunocytochemistry/ Immunofluorescence Netrin-G1a Antibody [Unconjugated]](https://images.novusbio.com/images/af1166_mouse-netrin-g1a-affinity-purified-polyclonal-ab-8220249503240.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Bioactivity Semaphorin 3A [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3A_1250S3_1473.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")