Home » RhoG » RhoG Proteins » RhoG Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RhoG Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RhoG Protein (NBP1-88832PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RhoG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOG.

Source: E. coli

Amino Acid Sequence: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88832.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RhoG Recombinant Protein Antigen

  • ARHGMGC125835
  • MGC125836
  • ras homolog gene family, member G (rho G)
  • RhoG
  • rho-related GTP-binding protein RhoG

Background

RhoG, also known as Rho-related GTP-binding protein RhoG, is a 21kDa 191 amino acid protein. RhoG plays a significant part in cell migration. RhoG has been researched in relation to Tangier disease, intrahepatic cholangiocarcinoma, shigellosis, cholangiocarcinoma, cholesterol and thyroiditis. RhoG has been linked to the axon guidance, cell adhesion, phagocytosis, cell motility and cell growth pathways where it interacts with VAV1, VAV2, ELMO1, MAP3K11 and ARHGDIG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rac1 Antibody
NB100-91266
Western Blot Rac1 Antibody
Immunohistochemistry Rac1 Antibody
Immunohistochemistry Rac1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RhoA Antibody
NB100-91273
Immunocytochemistry/ Immunofluorescence RhoA Antibody
Immunohistochemistry-Paraffin RhoA Antibody
Immunocytochemistry/ Immunofluorescence RhoA Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western Blot SOS2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
DOCK1 Antibody
NBP1-30945
Western Blot DOCK1 Antibody
Immunocytochemistry/ Immunofluorescence DOCK1 Antibody
Immunohistochemistry-Paraffin DOCK1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ELMO1 Antibody
NBP1-33645
Immunocytochemistry/ Immunofluorescence ELMO1 Antibody
Immunohistochemistry-Paraffin ELMO1 Antibody
Western Blot ELMO1 Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
GEF-H1 Antibody
NBP2-21577
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
ELMO2 Antibody
NB100-879
Immunohistochemistry-Paraffin ELMO2 Antibody
Western Blot ELMO2 Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot SLC2A4RG Antibody (4C10)
Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10)
Species: Hu
Applications: ELISA, ICC/IF, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot NCOA3/AIB1 Antibody
Western Blot NCOA3/AIB1 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
RhoGDI Antibody
(OTI1F2) - Azide and ...
NBP2-73890
Western Blot RhoGDI Antibody (OTI1F2) - Azide and BSA Free
Western Blot RhoGDI Antibody (OTI1F2) - Azide and BSA Free
Flow Cytometry RhoGDI Antibody (OTI1F2) - Azide and BSA Free
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
RAC3 Antibody
NBP2-32058
Western Blot RAC3 Antibody
Immunohistochemistry-Paraffin RAC3 Antibody
Immunohistochemistry-Paraffin RAC3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RAC2 Antibody
NBP3-35170
Immunohistochemistry RAC2 Antibody
Immunohistochemistry RAC2 Antibody
Western Blot RAC2 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RhoG Recombinant
Protein Antigen
NBP1-88832PEP
RhoG Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RhoG Protein (NBP1-88832PEP) (0)

There are no publications for RhoG Protein (NBP1-88832PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoG Protein (NBP1-88832PEP) (0)

There are no reviews for RhoG Protein (NBP1-88832PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RhoG Protein (NBP1-88832PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoG Products

Research Areas for RhoG Protein (NBP1-88832PEP)

Find related products by research area.

Blogs on RhoG

There are no specific blogs for RhoG, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RhoG Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RHOG