![Western Blot: RBM25 Antibody [NBP1-83418] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MOLT-4](http://images.novusbio.com/fullsize/RBM25-Antibody-Western-Blot-NBP1-83418-img0009.jpg "Western Blot: RBM25 Antibody [NBP1-83418] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MOLT-4")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV |
| Predicted Species | Mouse (100%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM25 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM25 |
![Immunocytochemistry/Immunofluorescence: RBM25 Antibody [NBP1-83418] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://images.novusbio.com/fullsize/RBM25-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83418-img0008.jpg "Immunocytochemistry/Immunofluorescence: RBM25 Antibody [NBP1-83418] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.")
![Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/RBM25-Antibody-Immunohistochemistry-Paraffin-NBP1-83418-img0013.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RBM25-Antibody-Immunohistochemistry-Paraffin-NBP1-83418-img0010.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RBM25-Antibody-Immunohistochemistry-Paraffin-NBP1-83418-img0011.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM25-Antibody-Immunohistochemistry-Paraffin-NBP1-83418-img0012.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human duodenum shows strong nuclear positivity in glandular cells.")
![Simple Western: RBM25 Antibody [NBP1-83418] - Simple Western lane view shows a specific band for RBM25 in 0.2 mg/ml of MOLT-4 (left) and A431 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/RBM25-Antibody-Simple-Western-NBP1-83418-img0006.jpg "Simple Western: RBM25 Antibody [NBP1-83418] - Simple Western lane view shows a specific band for RBM25 in 0.2 mg/ml of MOLT-4 (left) and A431 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: RBM25 Antibody [NBP1-83418] - Electropherogram image of the corresponding Simple Western lane view. RBM25 antibody was used at 1:25 dilution on MOLT-4 and A431 lysate(s) respectively.](http://images.novusbio.com/fullsize/RBM25-Antibody-Simple-Western-NBP1-83418-img0007.jpg "Simple Western: RBM25 Antibody [NBP1-83418] - Electropherogram image of the corresponding Simple Western lane view. RBM25 antibody was used at 1:25 dilution on MOLT-4 and A431 lysate(s) respectively.")
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")