![Western Blot: Rab2 Antibody [NBP2-82323] - RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.](http://images.novusbio.com/fullsize/Rab2-Antibody-Western-Blot-NBP2-82323-img0001.jpg "Western Blot: Rab2 Antibody [NBP2-82323] - RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rab2. Peptide sequence: NTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Rab2 Antibody (NBP2-82323)Find related products by research area.
|
|
GAPDH - A "Housekeeping" Gene With Diverse Functions in Cellular Homeostasis Glyceraldehyde 3-phosphate dehydrogenase (GAPDH) is a well-known housekeeping gene with functions in glycolysis. Many biologists are familiar with the gene and use GAPDH antibodies for a loading control when performing western blots. However, this ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB2A |
![Western Blot: Rab2 Antibody [NBP2-82323] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab2A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Ima](http://images.novusbio.com/fullsize/Rab2-Antibody-Western-Blot-NBP2-82323-img0002.jpg "Western Blot: Rab2 Antibody [NBP2-82323] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab2A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Ima")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
