Home » Pyridoxal Kinase/PDXK » Pyridoxal Kinase/PDXK Proteins » Pyridoxal Kinase/PDXK Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Pyridoxal Kinase/PDXK Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Pyridoxal Kinase/PDXK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDXK.

Source: E. coli

Amino Acid Sequence: FSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDXK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88282.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pyridoxal Kinase/PDXK Recombinant Protein Antigen

  • C21orf124
  • C21orf97
  • chromosome 21 open reading frame 124
  • DKFZp566A071
  • EC 2.7.1.35
  • FLJ21324
  • FLJ37311
  • HEL-S-1a
  • MGC15873
  • MGC31754
  • MGC52346
  • PDXK
  • PKH
  • PKHchromosome 21 open reading frame 97
  • PNK
  • PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940
  • PRED79
  • pyridoxal (pyridoxine, vitamin B6) kinase
  • Pyridoxal Kinase
  • pyridoxamine kinase
  • Pyridoxine kinase
  • Vitamin B6 Kinase

Background

Pyridoxal Kinase/PDXK is encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PDXP Antibody -
Azide and BSA Free
NBP2-93574
Western Blot PDXP Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PDXP Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin PDXP Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin Myelin PLP Antibody
Immunohistochemistry-Paraffin Myelin PLP Antibody
Immunohistochemistry-Paraffin Myelin PLP Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Peroxiredoxin 5
Antibody [Unconjugate
AF5724
Western Blot Peroxiredoxin 5 Antibody [Unconjugated]
Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]
Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: ICC, WB
PTHLH/PTHrP
Antibody (677939) [Un ...
MAB6734
Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC
PNPO Antibody
(OTI1G9)
NBP2-45361
Flow Cytometry PNPO Antibody (OTI1G9)
Flow Cytometry PNPO Antibody (OTI1G9)
Immunohistochemistry PNPO Antibody (OTI1G9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
HOXA10 Antibody -
BSA Free
NBP3-04877
Western Blot HOXA10 Antibody - BSA Free
Western Blot HOXA10 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Species: Hu
Applications: IHC, IHC-P
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Species: Hu
Applications: IHC, IHC-P, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin Ornithine Decarboxylase Antibody (ODC1/485)
Immunocytochemistry/ Immunofluorescence Ornithine Decarboxylase Antibody (ODC1/485)
Western Blot Ornithine Decarboxylase Antibody (ODC1/485)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
ZAK Antibody (3G5)
H00051776-M03
Western Blot ZAK Antibody (3G5)
Immunocytochemistry/ Immunofluorescence ZAK Antibody (3G5)
Immunohistochemistry-Paraffin ZAK Antibody (3G5)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Carbonic Anhydrase
II/CA2 Antibody
NB600-919
Western Blot Carbonic Anhydrase II/CA2 Antibody
Western Blot Carbonic Anhydrase II/CA2 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase II/CA2 Antibody
(3 Reviews)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
PRB1 Antibody
NBP3-41252
PRB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, WB
Pyridoxal
Kinase/PDXK Recombina ...
NBP1-88282PEP
Pyridoxal Kinase/PDXK Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP) (0)

There are no publications for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP) (0)

There are no reviews for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pyridoxal Kinase/PDXK Protein (NBP1-88282PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pyridoxal Kinase/PDXK Products

Blogs on Pyridoxal Kinase/PDXK

There are no specific blogs for Pyridoxal Kinase/PDXK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) - BSA Free [NB100-116] - APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
APE Antibody (13B8E5C2) - BSA Free
NB100-116
Flow Cytometry: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Flow cytometric analysis of paraformaldehyde fixed U2OS cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Pancreatic Polypeptide/PP Antibody
NB100-1793

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pyridoxal Kinase/PDXK Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDXK