Novus Biologicals products are now on bio-techne.com

Proteasome 20S alpha 5 Recombinant Protein Antigen

Images

 
There are currently no images for Proteasome 20S alpha 5 Protein (NBP1-86838PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Proteasome 20S alpha 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMA5.

Source: E. coli

Amino Acid Sequence: ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86838.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome 20S alpha 5 Recombinant Protein Antigen

  • EC 3.4.25.1
  • FLJ42315
  • macropain subunit zeta
  • Macropain zeta chain
  • MGC117302
  • MGC125802
  • MGC125803
  • MGC125804
  • Multicatalytic endopeptidase complex zeta chain
  • proteasome (prosome, macropain) subunit, alpha type, 5
  • Proteasome 20S alpha 5
  • proteasome alpha 5 subunit
  • proteasome component 5
  • proteasome subunit alpha type-5
  • proteasome subunit zeta
  • Proteasome zeta chain
  • PSC5
  • PSMA5
  • ZETA

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13820
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03836
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-92293
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-92294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33380
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-81768
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF482
Species: Mu
Applications: IHC, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-86838PEP
Species: Hu
Applications: AC

Publications for Proteasome 20S alpha 5 Protein (NBP1-86838PEP) (0)

There are no publications for Proteasome 20S alpha 5 Protein (NBP1-86838PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S alpha 5 Protein (NBP1-86838PEP) (0)

There are no reviews for Proteasome 20S alpha 5 Protein (NBP1-86838PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/Â¥70 Yuan/Â¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/Â¥150 Yuan/Â¥2500 Yen

FAQs for Proteasome 20S alpha 5 Protein (NBP1-86838PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome 20S alpha 5 Products

Research Areas for Proteasome 20S alpha 5 Protein (NBP1-86838PEP)

Find related products by research area.

Blogs on Proteasome 20S alpha 5

There are no specific blogs for Proteasome 20S alpha 5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome 20S alpha 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA5