![Immunocytochemistry/Immunofluorescence: Plexin A1 Antibody [NBP1-82544] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82544-img0005.jpg "Immunocytochemistry/Immunofluorescence: Plexin A1 Antibody [NBP1-82544] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVAQEGSPILRDLVLSPNHQYLYAMTEKQVT |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLXNA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Plexin A1 Antibody (NBP1-82544)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLXNA1 |
![Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunohistochemistry-Paraffin-NBP1-82544-img0010.jpg "Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human lung shows strong cytoplasmic postivity in macrophages.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunohistochemistry-Paraffin-NBP1-82544-img0006.jpg "Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human lung shows strong cytoplasmic postivity in macrophages.")
![Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human cerebellum shows moderate cytoplsmic postivity in Purkinje cells.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunohistochemistry-Paraffin-NBP1-82544-img0007.jpg "Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human cerebellum shows moderate cytoplsmic postivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunohistochemistry-Paraffin-NBP1-82544-img0008.jpg "Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Plexin-A1-Antibody-Immunohistochemistry-Paraffin-NBP1-82544-img0009.jpg "Immunohistochemistry-Paraffin: Plexin A1 Antibody [NBP1-82544] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9968.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9969.jpg)
![Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af660_human-ctgf-ccn2-c-terminus-affinity-purified-polyclonal-ab-822024951141.jpg)
![Western Blot Cyr61/CCN1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyr61_AF4055_Western_Blot_5394.jpg)
![Immunohistochemistry Cyr61/CCN1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyr61_AF4055_Immunohistochemistry_6819.jpg)
![Simple Western Cyr61/CCN1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyr61_AF4055_Simple_Western_20498.jpg)
![Bioactivity Semaphorin 3A [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3A_1250S3_1473.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")