![Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Analysis in human fallopian tube and skeletal muscle tissues using NBP1-87203 antibody. Corresponding Phosphoserine phosphatase RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Immunohistochemistry-Paraffin-NBP1-87203-img0016.jpg "Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Analysis in human fallopian tube and skeletal muscle tissues using NBP1-87203 antibody. Corresponding Phosphoserine phosphatase RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSPH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Bioactivity ASIP [Unconjugated]](https://images.novusbio.com/images2/ASIP_9094AG_1188.jpg)
| Publication using NBP1-87203 | Applications | Species |
|---|---|---|
| Possemato R, Marks KM, Shaul YD et al. Functional genomics reveal that the serine synthesis pathway is essential in breast cancer. Nature 2011-08-01 [PMID: 21760589] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Phosphoserine phosphatase Antibody (NBP1-87203)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Phosphoserine phosphatase Antibody [NBP1-87203] - Analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Western-Blot-NBP1-87203-img0009.jpg "Western Blot: Phosphoserine phosphatase Antibody [NBP1-87203] - Analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.")
![Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Immunohistochemistry-Paraffin-NBP1-87203-img0012.jpg "Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Immunohistochemistry-Paraffin-NBP1-87203-img0013.jpg "Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Immunohistochemistry-Paraffin-NBP1-87203-img0014.jpg "Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human skeletal muscle shows no postivity in myocytes as expected.](http://images.novusbio.com/fullsize/Phosphoserine-phosphatase-Antibody-Immunohistochemistry-Paraffin-NBP1-87203-img0015.jpg "Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human skeletal muscle shows no postivity in myocytes as expected.")
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Western_Blot_11615.jpg)
![Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Immunohistochemistry_11705.jpg)
![Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Flow_Cytometry_11747.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")