![Western Blot: HRSP12 Antibody [NBP1-82452] - Analysis using Anti-RIDA antibody NBP1-82452 (A) shows similar pattern to independent antibody NBP1-82453 (B).](http://images.novusbio.com/fullsize/HRSP12-Antibody-Western-Blot-NBP1-82452-img0010.jpg "Western Blot: HRSP12 Antibody [NBP1-82452] - Analysis using Anti-RIDA antibody NBP1-82452 (A) shows similar pattern to independent antibody NBP1-82453 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RIDA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Bioactivity ASIP [Unconjugated]](https://images.novusbio.com/images2/ASIP_9094AG_1188.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
| Publication using NBP1-82452 | Applications | Species |
|---|---|---|
| Dhawan L, Liu B, Pytlak A et al. Y-box binding protein-1 and Ribonuclease UK114 mediate MCP-1 mRNA stability in vascular smooth muscle cells. Mol Cell Biol 2012-07-31 [PMID: 22801372] |
Secondary Antibodies |
Isotype Controls |
Research Areas for HRSP12 Antibody (NBP1-82452)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RIDA |
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0021.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Western Blot: HRSP12 Antibody [NBP1-82452] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://images.novusbio.com/fullsize/HRSP12-Antibody-Western-Blot-NBP1-82452-img0008.jpg "Western Blot: HRSP12 Antibody [NBP1-82452] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Analysis in human liver and skin tissues. Corresponding HRSP12 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0015.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Analysis in human liver and skin tissues. Corresponding HRSP12 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human fallopian tube, kidney, liver and skin using Anti-HRSP12 antibody NBP1-82452 (A) shows similar protein distribution across tissues to independent antibody NBP1-82453 (B).](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0016.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human fallopian tube, kidney, liver and skin using Anti-HRSP12 antibody NBP1-82452 (A) shows similar protein distribution across tissues to independent antibody NBP1-82453 (B).")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0017.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0018.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human liver shows weak to moderate cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/HRSP12-Antibody-Immunohistochemistry-NBP1-82452-img0019.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human liver shows weak to moderate cytoplasmic and nuclear positivity in hepatocytes.")
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Western_Blot_11615.jpg)
![Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Immunohistochemistry_11705.jpg)
![Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Flow_Cytometry_11747.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")