Home » Ropporin 1-like » Ropporin 1-like Antibodies » Ropporin 1-like Antibody
Novus Biologicals products are now on bio-techne.com

Ropporin 1-like Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Ropporin 1-like Antibody [NBP2-47299] - Analysis in control (vector only transfected HEK293T lysate) and ROPN1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Ropporin 1-like Antibody [NBP2-47299] - Analysis in control (vector only transfected HEK293T lysate) and ROPN1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining in human testis and prostate tissues using NBP2-47299 antibody. Corresponding ROPN1L RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
Independent Antibodies: Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human bronchus, fallopian tube, liver and testis using Anti-ROPN1L antibody NBP2-47299 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Ropporin 1-like Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLL
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROPN1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ropporin 1-like Protein (NBP2-47299PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ropporin 1-like Antibody

  • AKAP-associated sperm protein
  • ASPFLJ23003
  • FLJ25776
  • radial spoke head 11 homolog
  • rhophilin associated tail protein 1-like
  • ROPN1-like protein
  • ropporin 1-like
  • ropporin-1-like protein
  • RSPH11

Background

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Complement Factor
D/Adipsin Antibody [U ...
AF5430
Western Blot Complement Factor D/Adipsin Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: IP, WB
ASRGL1 Antibody
NBP1-89133
Immunocytochemistry/ Immunofluorescence ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(186 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HRSP12 Antibody
NBP1-82452
Western Blot HRSP12 Antibody
Western Blot HRSP12 Antibody
Immunohistochemistry-Paraffin HRSP12 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PSP/BPIFA2
Antibody (1F12) - BSA
NBP2-37493
ELISA PSP/BPIFA2 Antibody (1F12) - BSA Free
Western Blot PSP/BPIFA2 Antibody (1F12) - BSA Free
Immunocytochemistry/ Immunofluorescence PSP/BPIFA2 Antibody (1F12) - BSA Free
(1 Publication)
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
Persephin Protein
NBP2-35208
SDS-PAGE Recombinant Human Persephin Protein
Species: Hu
Applications: BA, PAGE
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB

Publications for Ropporin 1-like Antibody (NBP2-47299) (0)

There are no publications for Ropporin 1-like Antibody (NBP2-47299).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ropporin 1-like Antibody (NBP2-47299) (0)

There are no reviews for Ropporin 1-like Antibody (NBP2-47299). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ropporin 1-like Antibody (NBP2-47299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ropporin 1-like Products

Blogs on Ropporin 1-like

There are no specific blogs for Ropporin 1-like, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ropporin 1-like Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ROPN1L